<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08341
Description |
Uncharacterized protein |
Sequence | MGDDDWPSQRFRDHVINRLEPELARNRQNAPNLPVPGDARQ |
Length | 41 |
Position | Tail |
Organism | Gongylonema pulchrum |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Spirurina> Spiruromorpha> Spiruroidea> Gongylonematidae> Gongylonema.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -1.349 |
Instability index | 59.28 |
Isoelectric point | 5.55 |
Molecular weight | 4782.19 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-KW
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP08341
No repeats found
No repeats found
|