<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08340
Description |
Uncharacterized protein |
Sequence | MSHMSLSVPPVDSVGSSVRHSSDSRNKTPILLDHDGNCPLDQYLYALSYLSRLGLALEAFRRDNRSSGSHPVIQFRHLITTPESVRFSVLGAAPPNLKHEPFVVNMNICLDEDTTTLKLKLDFEGEDIPSDSDIRIAELYFVRCVARLGNEIAVIAFANACRVASPGVFSAIARVMXXXXTYASQNCTL |
Length | 189 |
Position | Tail |
Organism | Gongylonema pulchrum |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Spirurina> Spiruromorpha> Spiruroidea> Gongylonematidae> Gongylonema.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.008 |
Instability index | 54.04 |
Isoelectric point | 6.04 |
Molecular weight | 20352.97 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP08340
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 72.93| 22| 94| 44| 65| 1
---------------------------------------------------------------------------
44- 65 (37.91/26.05) LYALSYLSRLG..LALEAFRRDNR
139- 162 (35.03/23.60) LYFVRCVARLGneIAVIAFANACR
---------------------------------------------------------------------------
|