<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08327
| Description |
Uncharacterized protein |
| Sequence | MNVALCVALEQVILRYWMWNTPQDMLVLCNTLLGKQGKLAAIFNTTTPGFCDQQRGGAPPERQYTNLHVSFEILRGVILCMLRALKMTGMEMTSDVMQRCNANFCWPVTINRTFSAQLVGCTVDDGSNTDTVMWEEVLALITQDVRQMQDIIYSHGLAADEQLLKIFTCDRRLLMLCYVYNMLYELKKVHPVLGSYPDLHNRIAALAHVIPSNKIVNTSASFFNKMSEYYSAVDIILIRAMETLVADQLFSTLMMCFKPCYRYHPQPAAFMYSVLYCLDKTISHTARARQFVLEICGQLEDRDGKYALLTPSFISDNHQLSLPSQFCQALVDRILQASNYPHQPPAFAYKALTGACIELLASPHAPAITARALIDLVFIRPLHQPYAFSLLFFSLLL |
| Length | 397 |
| Position | Tail |
| Organism | Gongylonema pulchrum |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Spirurina> Spiruromorpha> Spiruroidea> Gongylonematidae> Gongylonema.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | 0.197 |
| Instability index | 36.06 |
| Isoelectric point | 6.81 |
| Molecular weight | 44970.13 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP08327
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 88.38| 26| 38| 322| 347| 3
---------------------------------------------------------------------------
322- 347 (50.53/35.34) LPSQFCQALVDRILQASNY..P.HQPPAF
360- 388 (37.85/24.62) LASPHAPAITARALIDLVFirPlHQPYAF
---------------------------------------------------------------------------
|