<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08326
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MDTAGSGVASSGSLRTKISLKGGYSQLSLVCPFHLMKPELPHQSVLLGSNDLLAEYDMSSAYQRFCGSKRLREDLGSFLPHLVGNFNFDNALEFSSLRMLVEKPPITGKEITGLSASAMAGFRLTPGAVPEPYSVHLPRYFDKAMNDPMNYDENGDETKHKRKYKWSLDDFDDADSDRKYRKHRGDDKDRKKEKKKKKDKKRKVSSVMFFIFLFSFA |
| Length | 217 |
| Position | Head |
| Organism | Gongylonema pulchrum |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Spirurina> Spiruromorpha> Spiruroidea> Gongylonematidae> Gongylonema.
|
| Aromaticity | 0.11 |
| Grand average of hydropathy | -0.668 |
| Instability index | 30.50 |
| Isoelectric point | 9.33 |
| Molecular weight | 24636.84 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP08326
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 98.07| 31| 37| 24| 60| 1
---------------------------------------------------------------------------
24- 60 (47.08/46.66) YSQLslvCPFHLMKPE....LPHqsvLLGSNDLLAEYDMSS
62- 96 (51.00/33.86) YQRF...CGSKRLREDlgsfLPH...LVGNFNFDNALEFSS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 86.74| 25| 28| 141| 165| 2
---------------------------------------------------------------------------
141- 165 (47.38/22.13) FDKAMNDPMNYDENGDE...TKHKRKYK
171- 198 (39.36/17.52) FDDADSDRKYRKHRGDDkdrKKEKKKKK
---------------------------------------------------------------------------
|