<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08323
| Description |
Mediator of RNA polymerase II transcription subunit 18 |
| Sequence | MADESLFSSACASYQCNECILYGSVLKEHEEQLLQRLRGLCDPGQHSFNEHEMVFSLKTGQDPDVTVRLRRKFGGPDANSFQWHFRYMGAAEADPQCPTIVRKSIDSLIYSSNMMEFVKTLGLRMDYEYLTKGYLFTKGNIKIIINNITRTEKIXXXXRMDYEYLTKGYLFTKGNIKIIINNITRTEKIGTYDPNVLKPLSDSLLIEMSVALPDNQEYMTTAKALRSFADQLNPICDMQKVEYWWRSG |
| Length | 248 |
| Position | Head |
| Organism | Gongylonema pulchrum |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Spirurina> Spiruromorpha> Spiruroidea> Gongylonematidae> Gongylonema.
|
| Aromaticity | 0.11 |
| Grand average of hydropathy | -0.389 |
| Instability index | 40.25 |
| Isoelectric point | 6.44 |
| Molecular weight | 28154.98 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP08323
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 133.05| 31| 32| 124| 154| 1
---------------------------------------------------------------------------
124- 154 (66.53/48.89) RMDYEYLTKGYLFTKGNIKIIINNITRTEKI
159- 189 (66.53/48.89) RMDYEYLTKGYLFTKGNIKIIINNITRTEKI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 61.21| 16| 30| 36| 64| 2
---------------------------------------------------------------------------
36- 51 (32.75/39.26) RL.RGLCDPGQHSFNEH
68- 84 (28.47/ 9.04) RLrRKFGGPDANSFQWH
---------------------------------------------------------------------------
|