<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08313

Description Uncharacterized protein
SequenceMLQLDVLFCQATQVLSEEMCWHAMIERYDRDAGILVITYWLKKAYRNRYTSQYKIKIYADKENGNRGLRVRHFPVGRGLPCLDDRTGLKRLAVFQKTLXXXXYKIKIYADKENGNRGLRVRHFPVGRGLPCLDDRTGAAPTVTYPLLGNESRDEEMLVISVNAFSGNVIATVQALGSCPELDELERLLDDRLRSCPELDELEQLLDDRLSLQSITKTMNRLRILLMLKRYRKAVSPLPVRIIPEKVLCARLSELPEIPKDRICLQFTKEDMYYLIVSFSSNEQAGIDIDMYLLSVIERKINMVRLHPSQLLTSVPESCFTTALSDSDMEPAKKRSRWLGDTSQLRSAVATLDDRLAFMRICEELDNRNVKYKPLSVEPTVGGLILHLTDFSEAIPSASENFFSSMVNCCLRLDTRTRVIWPFECSLTNTPLTADFHESTLPGSYDSAKTKTTVMEIHGTGGVSSPNTSESVSTHMIDRLVVFAHMFDAVNKFAIAYYNHFNKFCNIVAFTYHKLVIAYGADRNMLMI
Length527
PositionTail
OrganismGongylonema pulchrum
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida> Spirurina> Spiruromorpha> Spiruroidea> Gongylonematidae> Gongylonema.
Aromaticity0.08
Grand average of hydropathy-0.173
Instability index44.08
Isoelectric point7.86
Molecular weight59605.24
Publications

Function

Annotated function
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP08313
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     158.74|      35|      49|      53|      87|       1
---------------------------------------------------------------------------
   53-   87 (79.37/52.49)	YKIKIYADKENGNRGLRVRHFPVGRGLPCLDDRTG
  103-  137 (79.37/52.49)	YKIKIYADKENGNRGLRVRHFPVGRGLPCLDDRTG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      38.28|      12|     144|     205|     220|       4
---------------------------------------------------------------------------
  205-  216 (18.75/17.69)	LDDRLSLQSITK
  221-  232 (19.53/ 6.14)	LRILLMLKRYRK
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP08313 with Med14 domain of Kingdom Metazoa

Unable to open file!