<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08305
Description |
Uncharacterized protein |
Sequence | MLARKPPFFRKKEDALEYLCDYKVPVGRALWFLKLIAVGGQGCTSNVNKQKKSTGDQLASEHAALFTKYVKLMLNQMSDSAKLESNIVYTDRWPHFIWICKHAYEDGMIEKQEFLMDLLDIFNDRFVQSPASTQNGVVWNSSQPHFKTLFRLFLMFFCQYTDQLTQNMVLARRCAFLVCRRLELYRDEAEQRDGRPVDCAELFDDMQQCIHQRAIILILC |
Length | 220 |
Position | Kinase |
Organism | Gongylonema pulchrum |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Spirurina> Spiruromorpha> Spiruroidea> Gongylonematidae> Gongylonema.
|
Aromaticity | 0.12 |
Grand average of hydropathy | -0.221 |
Instability index | 41.57 |
Isoelectric point | 8.04 |
Molecular weight | 25770.64 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP08305
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 60.81| 16| 48| 81| 96| 2
---------------------------------------------------------------------------
81- 96 (30.40/18.81) AKLESNIVYTDRWPHF
131- 146 (30.42/18.83) ASTQNGVVWNSSQPHF
---------------------------------------------------------------------------
|