Description | Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MSTTIGDANSTDELYSISWSNPAWSHLLSSVNVLDYFCDLSNPFYDRQCNNEVVRMQRLSPEQLLCMTGIEFYLDQAQEPILFVIRKQRRLSSTEVTPLAYYYIINGTVLQAPDLGALLNSRLLTTVNNLTKTLQASQPVLCVLYVSSSRISAVNYRVFFDE |
Length | 162 |
Position | Head |
Organism | Echinostoma caproni |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Platyhelminthes> Trematoda> Digenea> Plagiorchiida> Echinostomata> Echinostomatoidea> Echinostomatidae> Echinostoma. |
Aromaticity | 0.10 |
Grand average of hydropathy | -0.008 |
Instability index | 53.09 |
Isoelectric point | 4.93 |
Molecular weight | 18419.74 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP08275 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 63.96| 17| 26| 37| 53| 1 --------------------------------------------------------------------------- 37- 53 (33.08/24.68) FCDLSNPFYDRQCNNEV 65- 81 (30.88/22.62) LCMTGIEFYLDQAQEPI --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) LFVIR 2) LYSISWSN 3) VNYRVFFDE 4) VTPLAYYYII | 82 14 154 96 | 86 21 162 105 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab