<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08261
Description |
Uncharacterized protein |
Sequence | MEQLVARPRARAVQLSMLIEFICQKVYTDLMRLVDLLPSKTDLEKKTEIATFFSRTRHLFIRLEALVKWSNNASKVDKCEVTLTLMSEAVDFPWRVLDVEFLIKDPATNAFSVSLQLDLLHGQAQRARLKRPADQLVIENYRPGQTLAISYWHGLSRNKFQALLSPDGKLLPVSYSLIIHVDPLDAQRPLCVSHRPELPATESHRIGTLLQDLRQTLMLLSPGPVRLADAPLCLYVPLLWPCHPEEYLQFRVDPTQGTISAACPLLTSTETDKLLVGPFSNTQPASSGSYEGFSRASVCAALSALESALNQPSTRRILPVTSSGTIVPPSNMETGLLATQNRSLRSLSQGEARWRAVICQALEHLRLCHGLLRLLRTAKANRPFWQPAKRCLPIVLTPTQISRAQKSDPPAWSTALVRFQQSLRWPIVFVQLLPNNEYYIVCEVTSAPALNVQYQYSLLVCAPVPPQAEITLDSRGLLVWSGGNVTQSTGILSPTGTNLFVQVTHFVPLQVGALLFENPSTSLSLLQSCTEKAKAKLLNQRKSRVTELLMRMSRNSFRSGAPITSSYVSLTSPKQCVLESQLITIPQLLRLCGTLEERILINCFSLELSRAGVVHDGVRYDESGYLSSIRLISIPFNQPSWQSSDVPPLSQYVRELVLRPHFDPFTHRRSWQLDIPFTGFLARLNXSQSNPTRFAVSTTSTSDSRMVCRPTGRFHCGREEYFK |
Length | 723 |
Position | Tail |
Organism | Echinostoma caproni |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Platyhelminthes> Trematoda>
Digenea> Plagiorchiida> Echinostomata> Echinostomatoidea> Echinostomatidae>
Echinostoma.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.082 |
Instability index | 50.84 |
Isoelectric point | 9.29 |
Molecular weight | 80878.53 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU365082
|
GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:UniProtKB-UniRule
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP08261
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 115.08| 37| 65| 251| 288| 1
---------------------------------------------------------------------------
180- 222 (55.26/27.04) HVDPLDAQ.RPLCvshrPELPATESHRIgtLLQDLRQTLMLLSP
251- 288 (59.82/33.44) RVDPTQGTiSAAC....PLLTSTETDKL..LVGPFSNTQPASSG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 39.47| 11| 57| 295| 305| 2
---------------------------------------------------------------------------
295- 305 (18.93/10.45) RASVCAALSAL
355- 365 (20.53/11.87) RAVICQALEHL
---------------------------------------------------------------------------
|