<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08248
| Description |
Uncharacterized protein |
| Sequence | MSSIFFVSLWCTDLCGIRWRQLVLGERPNAAGDPLDDPVVRSYSKCLAVDILCVWRRVVAPKPKPKPEPDPSNMFDMSIPGTGNSGSVVHPPLSLTAAKELWIFWYGEEPDLKDLVAPELLNSSVATATSE |
| Length | 131 |
| Position | Middle |
| Organism | Anopheles stephensi (Indo-Pakistan malaria mosquito) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Nematocera> Culicoidea> Culicidae>
Anophelinae> Anopheles.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.031 |
| Instability index | 51.42 |
| Isoelectric point | 4.95 |
| Molecular weight | 14413.44 |
| Publications | PubMed=25244985
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP08248
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 63.58| 18| 35| 14| 34| 1
---------------------------------------------------------------------------
14- 34 (26.88/23.50) LCGirWRQlVLGERPNAAGDP
52- 69 (36.70/20.37) LCV..WRR.VVAPKPKPKPEP
---------------------------------------------------------------------------
|