<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08236
Description |
Uncharacterized protein |
Sequence | LFDYAEHDLWHIIKFHRAAKATKKPVMVPKGMVKSLLYQILDGIHYLHSNWVLHRDLKPANILVMGEGNERGRVKIADMGFARLFNAPLKPLADLDPVVVTFWYRAPELLLGARHYTKAIDIWAIGCIFAELLTSEPIFHCRQEDIKTSNPYHHDQLDRIFNVMGFPQDKDWEDIRKMPEHHTLTKDFKRSK |
Length | 192 |
Position | Kinase |
Organism | Anopheles stephensi (Indo-Pakistan malaria mosquito) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Nematocera> Culicoidea> Culicidae>
Anophelinae> Anopheles.
|
Aromaticity | 0.11 |
Grand average of hydropathy | -0.318 |
Instability index | 39.17 |
Isoelectric point | 8.80 |
Molecular weight | 22451.85 |
Publications | PubMed=25244985
|
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | ATP binding GO:0005524 IEA:InterPro
protein kinase activity GO:0004672 IEA:InterPro
|
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP08236
No repeats found
|