<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08230
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MVGKGKLPVESEDAHKLRFQVELEFVQCLANPNYLHFLAQRGYFKDAAFVNYLKYLLYWKEPEYAKYLKFPMCLYFLDLLQYEHFRREIVSAQCCKFIDDQAILLWQHYTRRRTRLTALGTTSLTGLAVGGQPVGGGVQGTLLSNDPAIMPNSGSTNNNGSNNGSAISNNGANSGGIGGIGSIGNNNGSSGSNSNNGPNSGIVNVPTSVAGQQQQNGAGLAQHNGVGGGGGGGGGGLLGNAMGTIGGGSGIPGGGINQKVP |
| Length | 261 |
| Position | Middle |
| Organism | Anopheles stephensi (Indo-Pakistan malaria mosquito) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Nematocera> Culicoidea> Culicidae>
Anophelinae> Anopheles.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.275 |
| Instability index | 30.47 |
| Isoelectric point | 8.86 |
| Molecular weight | 27167.08 |
| Publications | PubMed=25244985
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP08230
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 103.41| 23| 23| 153| 175| 1
---------------------------------------------------------------------------
130- 151 (30.60/ 6.79) .GGQPVGGGVQGTLL..SNDPAIMP
153- 175 (38.54/10.15) SGSTNNNGSNNGSAI..SNNGANSG
177- 201 (34.27/ 8.35) IGGIGSIGNNNGSSGsnSNNGPNSG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 58.82| 17| 17| 219| 235| 2
---------------------------------------------------------------------------
209- 225 (29.87/ 9.79) VAGQQQQNGAGL.AQHNG
226- 243 (28.95/ 9.26) VGGGGGGGGGGLlGNAMG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 70.41| 14| 15| 25| 38| 3
---------------------------------------------------------------------------
25- 38 (28.69/17.65) FVQCLANPNYLHFL
49- 56 (15.06/ 6.54) FV......NYLKYL
64- 77 (26.66/15.99) YAKYLKFPMCLYFL
---------------------------------------------------------------------------
|