<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08208
| Description |
Mediator of RNA polymerase II transcription subunit 29 |
| Sequence | MMNQMGMMMQQQGVGVPGGPGGVGGVGMPGPGGVGVAPGMMQSPQMQQAQQQQVQQQQVQQQQVQQQQVQQQQQQQVQQQQQQQQHSQSAQQQAQQTEKVDNISKVKVLVGPLRDALSTTIKTAAQLIQQNTLADAGSKTVDLNNAPRFDKHLEEFYSICDQIELNLKTTKLCMQQCTSSQQYLPIPVATSQPPLPETNALTYNQYLEVVKLQIGYAKDIHDTLICAAQNISPSE |
| Length | 235 |
| Position | Tail |
| Organism | Anopheles quadriannulatus (Mosquito) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Nematocera> Culicoidea> Culicidae>
Anophelinae> Anopheles.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.625 |
| Instability index | 65.36 |
| Isoelectric point | 5.56 |
| Molecular weight | 25781.82 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP08208
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.41| 13| 15| 55| 68| 1
---------------------------------------------------------------------------
55- 68 (24.01/ 8.83) QQQQVQQQQvQQQQ
73- 85 (28.41/ 8.14) QQQQVQQQQ.QQQQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 71.42| 22| 108| 106| 128| 4
---------------------------------------------------------------------------
106- 128 (31.88/31.73) VKVLVGPLRDALSTTIkTAAQLI
210- 231 (39.55/33.45) VKLQIGYAKDIHDTLI.CAAQNI
---------------------------------------------------------------------------
|