<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08204

Description Mediator of RNA polymerase II transcription subunit 31
SequenceMANKMVGKGKLPVESEDAQKLRFQVELEFVQCLANPNYLHFLAQRGYFKDAAFVNYLKYLLYWKEPEYAKYLKFPMCLYFLDLLQYEHFRREIVSAQCCKFIDDQAILLWQHYTRRRTRLTALGTTSLTGLAVGGQPVGGGVQGTLLSNDPAIMPNSSSNNGSNNGSTNSSNNGAGGGTGGVGGVGGISNANNGSSNNGPNSGSVNVPSSVGQQQQQNGAGITQHNGVGGGGGVVGGGGMLGNPMGALGGGGSSLPGGGGINQKVP
Length266
PositionMiddle
OrganismAnopheles quadriannulatus (Mosquito)
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Diptera> Nematocera> Culicoidea> Culicidae> Anophelinae> Anopheles.
Aromaticity0.08
Grand average of hydropathy-0.313
Instability index38.08
Isoelectric point9.02
Molecular weight27650.64
Publications









Function






Annotated function

Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. 


ECO:0000256	RuleBase:RU364129

GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription, DNA-templated	GO:0006355	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP08204
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      94.37|      30|      36|     139|     174|       2
---------------------------------------------------------------------------
  139-  174 (51.31/33.39)	GGG......VQGtlLSNdpaiMPNSSSNNGSNNGSTN..SS......NNG
  176-  219 (43.06/17.09)	GGGtggvggVGG..ISN....ANNGSSNNGPNSGSVNvpSSvgqqqqQNG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|      95.83|      22|      23|      70|      91|       3
---------------------------------------------------------------------------
   21-   43 (22.38/14.05)	..LRFQVELEFVQ...CLanpN...YLHF..LA
   49-   68 (16.14/ 8.38)	KDAAFVNYLKYLL...YW...KepeY.......
   70-   91 (42.09/31.93)	KYLKFPMCLYFLD...LL...Q...YEHF..RR
   96-  117 (15.23/ 7.55)	.....AQCCKFIDdqaIL...L...WQHYtrRR
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP08204 with Med31 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) NDPAIMPNSSSNNGSNNGSTNSSNNGAGGGTGGVGGVGGISNANNGSSNNGPNSGSVNVPSSVGQQQQQNGAGITQHNGVGGGGGVVGGGGMLGNPMGALGGGGSSLPGGGGINQKVP
149
266










Molecular Recognition Features






MoRF SequenceStartStop




NANANA