<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08204
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MANKMVGKGKLPVESEDAQKLRFQVELEFVQCLANPNYLHFLAQRGYFKDAAFVNYLKYLLYWKEPEYAKYLKFPMCLYFLDLLQYEHFRREIVSAQCCKFIDDQAILLWQHYTRRRTRLTALGTTSLTGLAVGGQPVGGGVQGTLLSNDPAIMPNSSSNNGSNNGSTNSSNNGAGGGTGGVGGVGGISNANNGSSNNGPNSGSVNVPSSVGQQQQQNGAGITQHNGVGGGGGVVGGGGMLGNPMGALGGGGSSLPGGGGINQKVP |
| Length | 266 |
| Position | Middle |
| Organism | Anopheles quadriannulatus (Mosquito) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Nematocera> Culicoidea> Culicidae>
Anophelinae> Anopheles.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.313 |
| Instability index | 38.08 |
| Isoelectric point | 9.02 |
| Molecular weight | 27650.64 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP08204
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 94.37| 30| 36| 139| 174| 2
---------------------------------------------------------------------------
139- 174 (51.31/33.39) GGG......VQGtlLSNdpaiMPNSSSNNGSNNGSTN..SS......NNG
176- 219 (43.06/17.09) GGGtggvggVGG..ISN....ANNGSSNNGPNSGSVNvpSSvgqqqqQNG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
4| 95.83| 22| 23| 70| 91| 3
---------------------------------------------------------------------------
21- 43 (22.38/14.05) ..LRFQVELEFVQ...CLanpN...YLHF..LA
49- 68 (16.14/ 8.38) KDAAFVNYLKYLL...YW...KepeY.......
70- 91 (42.09/31.93) KYLKFPMCLYFLD...LL...Q...YEHF..RR
96- 117 (15.23/ 7.55) .....AQCCKFIDdqaIL...L...WQHYtrRR
---------------------------------------------------------------------------
|