Description | Mediator of RNA polymerase II transcription subunit 6 |
Sequence | GKEKKPKRKHHPHSPITTCILSIRCDFLPTAMNPGRLGLTPIVQENPLWISWHDSNWIPVLNPGNVMDYFSEKSNPFYDRTCNNEIVRMQRQSLELLNNMTGVEYIPLHVQDPILYVIRKQHRHSPTEATPMADYYIIAGTVYQAPDLASVFNSRILSTVHHLQTAFDEASSYSRYHPSKGYSWDFSSNKAIAEKTKTQTKKEAPVKEEPSSLFQRQRVDMLLGDLLRKFPLPLPQMTNNQAGVNSSEGNNANNNHTGAAGENEHTGSEHPMIKQEPSDSGVGRGSSNEVPPEKKIKL |
Length | 298 |
Position | Head |
Organism | Anopheles minimus |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Diptera> Nematocera> Culicoidea> Culicidae> Anophelinae> Anopheles. |
Aromaticity | 0.07 |
Grand average of hydropathy | -0.723 |
Instability index | 40.68 |
Isoelectric point | 8.35 |
Molecular weight | 33609.49 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP08182 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 34.12| 9| 27| 26| 35| 2 --------------------------------------------------------------------------- 26- 35 (14.49/12.73) DFLPtAMNPG 56- 64 (19.62/11.82) NWIP.VLNPG --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) HTGSEHPMIKQEPSDSGVGRGSSNEVPPEKKIKL 2) KPKRKHHPHSPITTCI | 265 5 | 298 20 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab