<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08179

Description Mediator of RNA polymerase II transcription subunit 28
SequenceMASSSNVSGNLVDELEESFQSCIHALTKEESATGIDKDEIKVEVDQTTLKFIDLARQMESFFLQKRFLLSALKQDLLMKEENFDLKQEISRKDELIRKHYEKIETWKQLLSDQQNFNKPIQSMPPDMRGNLAGGAPGAPAGLMASGGMNLPMQVSKTMQNQHQQQMQQMQVQQQQMQQQMQQSMPMGASNAQLFQQGGMPRGVGQGGSGAGFPQGGGPNLQGPLAYLEKTASNIDLVGLGDGRR
Length244
PositionHead
OrganismAnopheles minimus
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Diptera> Nematocera> Culicoidea> Culicidae> Anophelinae> Anopheles.
Aromaticity0.05
Grand average of hydropathy-0.640
Instability index55.06
Isoelectric point5.47
Molecular weight26933.27
Publications









Function






Annotated function


GO - Cellular Component
nucleus	GO:0005634	IEA:UniProtKB-SubCell

GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP08179
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      51.05|      13|      16|     187|     200|       1
---------------------------------------------------------------------------
  187-  200 (23.73/14.64)	GASNAQlFQQGGMP
  206-  218 (27.32/13.11)	GGSGAG.FPQGGGP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      54.41|      18|      59|     107|     124|       2
---------------------------------------------------------------------------
   73-   93 (21.65/12.72)	KQdLLMKEENFDlkQEISRKD
  107-  124 (32.76/22.77)	KQ.LLSDQQNFN..KPIQSMP
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP08179 with Med28 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) QNFNKPIQSMPPDMRGNLAGGAPGAPAGLMASGGMNLPMQVSKTMQNQHQQQMQQMQVQQQQMQQQMQQSMPMGASNAQLFQQGGMPRGVGQGGSGAGFPQGGGPNLQGPLAYL
114
227










Molecular Recognition Features






MoRF SequenceStartStop




NANANA