<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08173
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MANKMVGKGKLPVESEDAQKLRFQVELEFVQCLANPNYLHFLAQRGYFKDAAFVNYLKYLLYWKEPEYAKYLKFPMCLYFLDLLQYEHFRREIVSAQCCKFIDDQAILLWQHYTRRRTRLTALGTTSLTGLAVGGQPVGGGVQGTLLSNEPAIMPNSSNNGSNNGNTISNNGGTNSGVGGIGSNNNGSSNNGPNSGNVNVPTSVGQPQQQQQQQQNGAGITQHNGVGGGGGILGNPLGSIGSGSGIPGGGINQKVP |
| Length | 256 |
| Position | Middle |
| Organism | Anopheles minimus |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Nematocera> Culicoidea> Culicidae>
Anophelinae> Anopheles.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.421 |
| Instability index | 35.29 |
| Isoelectric point | 9.02 |
| Molecular weight | 27338.32 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP08173
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 120.52| 28| 28| 157| 184| 1
---------------------------------------------------------------------------
157- 184 (53.71/22.76) SSNNGSNNGNTISNNGGTNSGVGGIGSN
210- 235 (39.28/14.80) .QQQQQQNGAGITQHNGVGGG.GGILGN
238- 252 (27.53/ 8.33) GS.IGS............GSGIPGGGIN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 20.79| 11| 15| 29| 42| 2
---------------------------------------------------------------------------
63- 83 ( 6.83/ 9.83) WkepEYAKYLkfpmclyFLDL
84- 98 (13.96/ 6.34) L...QYEHFR...reivSAQC
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 26.95| 8| 15| 29| 42| 3
---------------------------------------------------------------------------
29- 42 (10.90/17.48) FVqclanpNYLHFL
53- 60 (16.06/ 6.80) FV......NYLKYL
---------------------------------------------------------------------------
|