<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08171
| Description |
Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MNPGRLGLAPLLQENPLWISWHDSNWIPVLNPGNVMDYFSEKSNPFYDRTCNNEIVRMQRQSLELLNNMTGVEYIPLHVQDPILYVIRKQHRHSPTEATPMADYYIIAGTVYQAPDLASVFNSRILSTVHHLQTAFDEASSYSRYHPSKGYSWDFSSNKASTHAMAEQVAEKTKTQTKKEAPVKEEPSSIFQRQRVDMLLGDLLRKFPLPLPQMTNNPTGGNPSDAGNASNNHGGAAGDSDHVGSDAILIKQEPTEAGVGRGGNNDVPPEKKMKL |
| Length | 275 |
| Position | Head |
| Organism | Anopheles merus (Mosquito) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Nematocera> Culicoidea> Culicidae>
Anophelinae> Anopheles.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.634 |
| Instability index | 44.97 |
| Isoelectric point | 6.20 |
| Molecular weight | 30625.99 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP08171
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 36.58| 12| 65| 10| 39| 1
---------------------------------------------------------------------------
1- 18 (19.07/29.09) MNPGRLglapllQENPLW
30- 47 (17.52/ 7.71) LNPGNVmdyfseKSNPFY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 82.35| 26| 162| 67| 98| 2
---------------------------------------------------------------------------
67- 98 (39.05/38.19) NNMTGVEYIPLHV.QDPILyvIRKQhrhsPTEA
231- 257 (43.30/24.93) NNHGGAAGDSDHVgSDAIL..IKQE....PTEA
---------------------------------------------------------------------------
|