<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08162
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MANKMVGKGKLPVESEDAQKLRFQVELEFVQCLANPNYLHFLAQRGYFKDAAFVNYLKYLLYWKEPEYAKYLKFPMCLYFLDLLQYEHFRREIVSAQCCKFIDDQAILLWQHYTRRRTRLTALGTTSLTGLAVGGQPVGGGVQGTLLSNDPAIMPNSSSNNGSNNGSSNSSNNGAGGGTGGVGGVGGISNANNGSSNNGPNSGSVNVPSSVGQQQQQQQQNGAGITQHNGVGGGGGVVGGGGMLGNPMGALGGGGSSLPGGGGINQKVP |
| Length | 269 |
| Position | Middle |
| Organism | Anopheles merus (Mosquito) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Nematocera> Culicoidea> Culicidae>
Anophelinae> Anopheles.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.349 |
| Instability index | 41.19 |
| Isoelectric point | 9.02 |
| Molecular weight | 28021.00 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP08162
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 104.47| 31| 45| 134| 176| 2
---------------------------------------------------------------------------
134- 171 (48.37/24.43) GGQPVGGgVQGtlLSNdpaiMPNSSSNNGSNNGSSN..SS
178- 210 (56.09/20.85) GTGGVGG.VGG..ISN....ANNGSSNNGPNSGSVNvpSS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 124.03| 40| 45| 27| 70| 3
---------------------------------------------------------------------------
15- 64 (59.31/60.67) SEDAQklrfqveLEFVQCLanpNYLHFLAQRGYFKDAAFVNYLKYL.....LYWK
66- 111 (64.71/49.23) PEYAK......yLKFPMCL...YFLDLLQYEHFRREIVSAQCCKFIddqaiLLWQ
---------------------------------------------------------------------------
|