<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08155
| Description |
Mediator of RNA polymerase II transcription subunit 21 |
| Sequence | LLVHQPLALGCLLSLVFFSFPLFLYFKIVGKLDYSIVFEAMADRLTQLQDTVNQQAEHFCNSIGILQQCSVPSKFAGFERTGSQTPQQQVHQQQQLPQQQQQQQQQQQEDFPQLFSTLISRCAKDIDTLIESLPSEESSIELQVQSLQRLEAENKESAEKLEEIVRKGELLLEKIQAALSDIAQSQLDMQYSS |
| Length | 193 |
| Position | Middle |
| Organism | Anopheles merus (Mosquito) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Nematocera> Culicoidea> Culicidae>
Anophelinae> Anopheles.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.308 |
| Instability index | 61.08 |
| Isoelectric point | 4.63 |
| Molecular weight | 21961.59 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU366036
|
| GO - Cellular Component | integral component of membrane GO:0016021 IEA:UniProtKB-KW
mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP08155
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 133.79| 38| 39| 38| 75| 1
---------------------------------------------------------------------------
38- 75 (65.63/28.38) FEAMADRLTQLQDTVNQQAEHFCNSIGILQQCSVPSKF
78- 115 (68.15/29.74) FERTGSQTPQQQVHQQQQLPQQQQQQQQQQQEDFPQLF
---------------------------------------------------------------------------
|