<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08126
Description |
Mediator of RNA polymerase II transcription subunit 28 |
Sequence | MASSSNVGSGNLVDELEEAFQSCIHALTKEESATGIDKDEIKVEVDQTTLKFIDLARQMEAFFLQKRFLLSALKPDLLLKEENFDLKQEIGRKDELIRKHYEKIESWKQLLSDQQNFNKPIQSMPPDMRGNLAGGAPGGGPAGMMASGGMNLPMQWAWETVEGDAGGAGDAVEVEAVEEAVDEHEKNMEQAKIIKESEMIETCLIYFGAAVISG |
Length | 214 |
Position | Head |
Organism | Anopheles melas |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Nematocera> Culicoidea> Culicidae>
Anophelinae> Anopheles.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.379 |
Instability index | 41.68 |
Isoelectric point | 4.53 |
Molecular weight | 23553.39 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP08126
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 72.17| 19| 30| 117| 136| 1
---------------------------------------------------------------------------
117- 136 (33.46/20.40) FNKPIQSMPPDMRGNlAGGA
150- 168 (38.70/19.96) MNLPMQWAWETVEGD.AGGA
---------------------------------------------------------------------------
|