<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08121
| Description |
Mediator of RNA polymerase II transcription subunit 10 |
| Sequence | MTSPLENLENHLEMFIENVRQIRIIVSDFQPQGQNVLNQKIQSLVTGLQEIDKLKNQIDVNVPLEVFDYIDQGRNPQLYTKDCIDKALTKNEEVKGKIDSYRKFKSNLMKELSETFPVEISKYKAIRGDE |
| Length | 130 |
| Position | Middle |
| Organism | Anopheles melas |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Nematocera> Culicoidea> Culicidae>
Anophelinae> Anopheles.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.623 |
| Instability index | 32.35 |
| Isoelectric point | 5.30 |
| Molecular weight | 15131.10 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP08121
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 39.55| 10| 38| 26| 35| 1
---------------------------------------------------------------------------
26- 35 (19.87/11.60) VSDFQPQGQN
66- 75 (19.68/11.45) VFDYIDQGRN
---------------------------------------------------------------------------
|