<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08120
| Description |
Uncharacterized protein |
| Sequence | PQQTDLCGIRWRQLVLGERPNAAGDPLDDPVVRSYSKCLAVDILCVWRRVVAPKPKPKPDPDPSSMFDMSIPGTGNSGSVVHPPLSLTAAKELWIFWYGEEPDLTDLVAPELLNSSDR |
| Length | 118 |
| Position | Middle |
| Organism | Anopheles melas |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Nematocera> Culicoidea> Culicidae>
Anophelinae> Anopheles.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.306 |
| Instability index | 45.46 |
| Isoelectric point | 4.83 |
| Molecular weight | 13008.71 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP08120
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 65.09| 18| 35| 6| 26| 1
---------------------------------------------------------------------------
6- 26 (27.51/20.85) LCGirWRQlVLGERPNAAGDP
44- 61 (37.58/18.24) LCV..WRR.VVAPKPKPKPDP
---------------------------------------------------------------------------
|