<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08119
| Description |
Mediator of RNA polymerase II transcription subunit 27 |
| Sequence | MNLEPINNALSQLRVLRSSVGQVFETLGTGVRADHGEEGKEQKFLQELQELLNSVNANLKDFESCINDLTPPQTPLTLANSAYLSLETNLERQALYPHLVQSYKWHDKLHEYSTFASTLLQQNSLKRSYYTNTKRRRSLPSSHLATPQMVENLIGSIHYNNMNLKIARPFMTNAILHITIARVLRAAVILKGLLIEWVTVKGYEESLLDGVDEQWTESRHQVFRKVQDHAHSAMLHFFSPTLPELAIRSFITWFRSYVTLFADPCKKCGKHLHNTLPPTWRDLRTLEPFHEECKQ |
| Length | 295 |
| Position | Tail |
| Organism | Anopheles melas |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Nematocera> Culicoidea> Culicidae>
Anophelinae> Anopheles.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.391 |
| Instability index | 54.00 |
| Isoelectric point | 8.29 |
| Molecular weight | 34020.47 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP08119
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 53.04| 15| 25| 252| 267| 1
---------------------------------------------------------------------------
252- 267 (26.68/22.49) TWfRSYVTL..FADPCKK
279- 295 (26.36/16.40) TW.RDLRTLepFHEECKQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 68.17| 20| 28| 113| 132| 4
---------------------------------------------------------------------------
113- 132 (33.02/23.45) STFASTLLQQNSLKRSYYTN
142- 161 (35.14/25.39) SHLATPQMVENLIGSIHYNN
---------------------------------------------------------------------------
|