<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08105

Description Mediator of RNA polymerase II transcription subunit 15
SequenceMNPMVMGQIQAQLQNQNAMGGQQMGTVGGTMNAANQMGPMVGSNAGMNPQAMGMTPNQVLRQQQQQQQGMAQVQMAMQQQQQQQHQQQAGGMGQAGPNQMNPGVPIGPGGGGVMGAGGPSQMLGAGTGGVAGQQGNFVGMGANTMVRKPPDMMPGGNVFSSGGVAVRSVTPNNFLRQSPSPSVPSPVGPGAHGPQSHPGQMIPSPALIPSPNPHMGGVAQRSNIGQSPGGSLNTPGQPGGAVPSPLNPQDEQLYREKYRALTKYIEPLKRMIAKMENDDIDKIAKMKRLLEILSNPSVRIPLETLHKCEAALTSQLGSIRETPTNNPLVEAVSSSLQGASGNHTLQRTFRPCLDALFGPDIKNLPPPAKQARLVQEDASIANGTTAAGVTSGGAPATTTSTTTAAISTTSSTNSSAGSATTTNTTVSNTAPQEIPHILQ
Length439
PositionTail
OrganismAnopheles maculatus
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Diptera> Nematocera> Culicoidea> Culicidae> Anophelinae> Anopheles> Anopheles maculatus group.
Aromaticity0.02
Grand average of hydropathy-0.455
Instability index54.12
Isoelectric point9.51
Molecular weight45172.54
Publications









Function






Annotated function

Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. 


ECO:0000256	RuleBase:RU364148

GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP08105
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      60.11|      15|      15|      53|      67|       1
---------------------------------------------------------------------------
   53-   67 (30.78/14.89)	GMTPNQVLRQQQQQQ
   69-   83 (29.33/13.85)	GMAQVQMAMQQQQQQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      56.58|      16|      16|     171|     186|       2
---------------------------------------------------------------------------
  171-  186 (30.49/ 9.76)	PNNFLRQS.PSPSVPSP
  189-  205 (26.09/ 7.29)	PGAHGPQShPGQMIPSP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      50.17|      14|      15|       6|      19|       4
---------------------------------------------------------------------------
    6-   19 (24.84/13.58)	MGQIQAQLQNQNAM
   24-   37 (25.33/14.01)	MGTVGGTMNAANQM
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      59.00|      18|      20|     384|     402|       6
---------------------------------------------------------------------------
  384-  402 (27.19/21.81)	TTAAGVTSGGApATTTSTT
  408-  425 (31.81/19.67)	TTSSTNSSAGS.ATTTNTT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      42.61|      11|      15|     210|     220|       8
---------------------------------------------------------------------------
  210-  220 (22.43/ 9.53)	SPNPHMGGVAQ
  227-  237 (20.18/ 7.76)	SPGGSLNTPGQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      52.11|      16|      19|     265|     280|       9
---------------------------------------------------------------------------
  265-  280 (26.96/22.05)	IEPLKRMIAKMENDDI
  283-  298 (25.15/20.07)	IAKMKRLLEILSNPSV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      35.20|      15|      19|     311|     328|      10
---------------------------------------------------------------------------
  301-  326 (13.85/14.28)	PLetlhkceaALTSqlgSIRETPTNN
  327-  343 (21.35/11.37)	PL......veAVSS...SLQGASGNH
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP08105 with Med15 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) LPPPAKQARLVQEDASIANGTTAAGVTSGGAPATTTSTTTAAISTTSSTNSSAGSATTTNTTVSNTAPQEIPHILQ
2) PMVMGQIQAQLQNQNAMGGQQMGTVGGTMNAANQMGPMVGSNAGMNPQAMGMTPNQVLRQQQQQQQGMAQVQMAMQQQQQQQHQQQAGGMGQAGPNQMNPGVPIGPGGGGVMGAGGPSQMLGAGTGGVAGQQGNFVGMGANTMVRKPPDMMPGGNVFSSGGVAVRSVTPNNFLRQSPSPSVPSPVGPGAHGPQSHPGQMIPSPALIPSPNPHMGGVAQRSNIGQSPGGSLNTPGQPGGAVPSPLNPQDEQL
364
3
439
253










Molecular Recognition Features






MoRF SequenceStartStop




NANANA