<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08091
Description |
Uncharacterized protein |
Sequence | MAPQPLEQGGAVTSFIPTGQEMAQRQNLIPLGRLIDFIIQRTYHELTVLAELLPRKTDMDRKIEIYNFSASTRQLFIRLLALVKWANSASKVDKSAKIMGFLDKQSMLFIDTADMLSRVARETLVHARLPNFHIPAAVEILTTGSYSRLPSVIRDRIVPPDPITPAEKRQTLQRLNQVIQHRLVTGSLLPQLRKFRIENGRVTFKVDHEFEVSLTVMGDAPTVPWRLLDIDFLVEDKETGDGKALVHPLQVNYIHQLIQGRIVDCTDALAEVYTCLHYFCQSLQLEVLYTQTLRLIRDRLDDHIHVDEYVVGSRLTVSYWRELTNKDPKSELGYRLTIQTDPNDAAKQLAILHVPSIGNKEADIADRAVRSDLLSMERLLVHTVYVRSLARLNDVKTEL |
Length | 399 |
Position | Tail |
Organism | Anopheles maculatus |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Nematocera> Culicoidea> Culicidae>
Anophelinae> Anopheles> Anopheles maculatus group.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.153 |
Instability index | 31.51 |
Isoelectric point | 7.21 |
Molecular weight | 45531.07 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU365082
|
GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:UniProtKB-UniRule
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP08091
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 39.40| 11| 23| 148| 158| 1
---------------------------------------------------------------------------
148- 158 (19.57/12.81) RLPSVIRDRIV
174- 184 (19.82/13.06) RLNQVIQHRLV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 63.90| 19| 23| 1| 22| 2
---------------------------------------------------------------------------
4- 22 (34.67/26.12) QPLEQGGAVTSFI..PTGQEM
26- 46 (29.24/12.70) QNLIPLGRLIDFIiqRTYHEL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 68.63| 22| 23| 237| 259| 5
---------------------------------------------------------------------------
237- 259 (33.52/27.95) K..ETGDGKALVHPLqVNYIHQLIQ
261- 284 (35.11/23.90) RivDCTDALAEVYTC.LHYFCQSLQ
---------------------------------------------------------------------------
|