<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08067
| Description |
Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MNPGRLGLTPMVQENPLWISWHDSNWIPVLNPGNVMDYFSEKSNPFYDRTCNNEIVRMQRQSLELLNNMTGVEYIPLHVQDPILYVIRKQHRHSPTEATPLADYYIIAGTVYQAPDLASVFNSRILSTVHHLQTAFDEASSYSRYHPSKGYSWDFSSNKAIAEKTKTQTKKEAPVKEEPSSIFQRQRVDMLLGDLLRKFPLPLPQMTNNPTGVNSSEGNNVNNNHSGGTGENDHTGSDHAMIKQEPTDGGGGGGRGSNSDAPPEKKMKL |
| Length | 269 |
| Position | Head |
| Organism | Anopheles funestus (African malaria mosquito) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Nematocera> Culicoidea> Culicidae>
Anophelinae> Anopheles.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.744 |
| Instability index | 42.97 |
| Isoelectric point | 6.36 |
| Molecular weight | 30094.26 |
| Publications | PubMed=21129198
PubMed=31157884
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP08067
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 69.50| 18| 31| 1| 18| 1
---------------------------------------------------------------------------
1- 18 (35.25/20.58) MNPGRLGLTPMVQENPLW
30- 47 (34.24/19.82) LNPGNVMDYFSEKSNPFY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 80.13| 23| 23| 208| 230| 2
---------------------------------------------------------------------------
208- 230 (41.72/20.08) NNPTGVNSS..EGNNVNNNHSGGTG
232- 256 (38.41/18.03) NDHTGSDHAmiKQEPTDGGGGGGRG
---------------------------------------------------------------------------
|