<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08063
| Description |
Cyclin C |
| Sequence | MAGNFWQSSHHQQWILDKQDLIRERQHDLKTLTEEEYQKIFMFFANIIQVLGEQLKLRQQVIATATVYFKRFYARNSLKCIDPLLLAPTCILLSSKVEEFGVISNSRLITTCQTVIKNKFGYAYQQEFPYRTNHILECEFYLLENLDCCLIVYQPYRPLLQLMQDIGQEEQLLTLTWRLINDSLRTDVSLLYPPYQIAIGCLQITCVILQKELKSWFAELNVDMDKVQEIARAIVNLFELWKGYDEKKEIQALLEKMPKPKPHPQR |
| Length | 266 |
| Position | Kinase |
| Organism | Anopheles farauti |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Nematocera> Culicoidea> Culicidae>
Anophelinae> Anopheles.
|
| Aromaticity | 0.11 |
| Grand average of hydropathy | -0.190 |
| Instability index | 49.86 |
| Isoelectric point | 6.53 |
| Molecular weight | 31457.30 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP08063
No repeats found
|