<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08044

Description Mediator of RNA polymerase II transcription subunit 29
SequenceMMNQMGMMMQQQGVGVPGGPGGVGGVGMPGPGGVGVAPGMMQSPQMQQAQQQQVQQQQQQVQQQQVQQQAQQQQQQHSQSAQQQAQQTEKVDNISKVKVLVGPLRDALSTTIKTAAQSIQQNTLADAGSXKTAKLCMQQCTSSQQYLPIPVATSQPPMPETNALTYNQYLEVVKLQISYAKDIHDTLICAAQNISPSE
Length198
PositionTail
OrganismAnopheles farauti
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Diptera> Nematocera> Culicoidea> Culicidae> Anophelinae> Anopheles.
Aromaticity0.02
Grand average of hydropathy-0.575
Instability index67.38
Isoelectric point6.71
Molecular weight21173.74
Publications









Function






Annotated function


GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP08044
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      83.40|      15|      15|      45|      59|       1
---------------------------------------------------------------------------
   45-   59 (30.08/ 8.58)	QMQQAQQQQVQQQQQ
   62-   75 (27.43/ 7.18)	QQQQVQQQA.QQQQQ
   76-   90 (25.89/ 6.36)	QHSQSAQQQAQQTEK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      46.88|      12|      17|       8|      21|       2
---------------------------------------------------------------------------
    8-   21 (20.83/13.48)	MMQQQGVGVpgGPG
   28-   39 (26.05/10.58)	MPGPGGVGV..APG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      38.10|      13|      17|     106|     121|       3
---------------------------------------------------------------------------
  106-  121 (17.44/16.84)	DALSttiKTAAQSIQQ
  126-  139 (20.65/10.88)	DAGS..xKTAKLCMQQ
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP08044 with Med29 domain of Kingdom Metazoa
Unable to open file!