<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08043
| Description |
Mediator of RNA polymerase II transcription subunit 17 |
| Sequence | MNPGRLALAQTAQENPLWISWHDSNWIPVLNPGNVMDYFSEKSNPFYDRTCNNEIVRMQRQSLELLNNMTGVEYIPLHVQDPILYVIRKQHRHSPTEATPMADYYIIAGTVYQAPDLASVFNSRILSTVHHLQNAFDEATTYSRYHPSKGYSWDFSSNKAIAEKTKTQTKKEPPVKEEPSSIFQRQRVDMLLGDLLRKFPLPLPQITNNPGGGNPADTNNVNINHSGAAGENDHTGTDQAMIKQEPSDSIGTAAGRAGNSDAPPDKKMKL |
| Length | 270 |
| Position | Head |
| Organism | Anopheles farauti |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Nematocera> Culicoidea> Culicidae>
Anophelinae> Anopheles.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.693 |
| Instability index | 41.15 |
| Isoelectric point | 6.30 |
| Molecular weight | 30215.46 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP08043
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 67.37| 18| 27| 1| 18| 1
---------------------------------------------------------------------------
1- 18 (33.20/20.34) MNPGRLALAQTAQENPLW
30- 47 (34.17/21.13) LNPGNVMDYFSEKSNPFY
---------------------------------------------------------------------------
|