Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | LAKMFNNYGNTMASDPFRKVEQYSPKSSPRAGGAGGRSPVVARQDSSGTLKTTIQLGKNPSILHSGPFYLMKEPPGEGELTGATNLMAHYGLEHSYSKFSGKKVKEQLSSFLPNLPGVIDGPGHLDNSSLRSVIEKPPIVGKELLPLTSVQLAGFRLHPGPLPEQYKHLKTAPTRKHKNKHKKHKHKDGVAPPEQSALEASGLDTHEKKHKKQKRHEDDKERKKRKKEKKRKKQRHSPEHPAGGGGGTTSIPPQTQVY |
Length | 258 |
Position | Head |
Organism | Anopheles farauti |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Diptera> Nematocera> Culicoidea> Culicidae> Anophelinae> Anopheles. |
Aromaticity | 0.05 |
Grand average of hydropathy | -1.059 |
Instability index | 57.91 |
Isoelectric point | 10.04 |
Molecular weight | 28422.05 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP08041 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 97.53| 25| 27| 163| 188| 1 --------------------------------------------------------------------------- 163- 185 (31.02/18.80) .......PEQyKHL.KTAPTRKHKNKHKKHK 186- 214 (38.91/19.39) HKDgvapPEQ.SAL.EASGLDTHEKKHKKQK 216- 235 (27.60/11.84) HED...........dKERKKRKKEKKRKKQR --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 53.06| 14| 210| 23| 40| 2 --------------------------------------------------------------------------- 23- 36 (26.39/18.44) YSPKSSPRAGGAGG 69- 82 (26.67/ 8.67) YLMKEPPGEGELTG --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) KKHKKQKRHEDDKERKKRKKEKKRKKQRHSPEHPA 2) TSIPPQTQVY | 208 249 | 242 258 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab