<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08037
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | PVESEDAQKLRFQVELEFVQCLANPNYLHFLAQRGYFKDAAFVNYLKYLLYWKDPEYAKYLKFPMCLYFLDLLQYEHFRREIVSAQCCKFIDDQAILLWQHYTRRRTRLTGLGTTSLTGLAVGGQPVGGGVQGTLLSNDPAIMPNSNNNGSNNGSSNSSNNGAGGGGVGGAGGGGIVGGLGGNNNGSSNNGPNSGSVNVSSSVGQQQQQQQNGAGIVQHNGVGGGGGVGGGGLLGNPMGAMGGGSSIPGGGIK |
| Length | 253 |
| Position | Middle |
| Organism | Anopheles epiroticus |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Nematocera> Culicoidea> Culicidae>
Anophelinae> Anopheles.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.322 |
| Instability index | 36.48 |
| Isoelectric point | 8.48 |
| Molecular weight | 26192.80 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP08037
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 150.11| 43| 58| 138| 195| 1
---------------------------------------------------------------------------
150- 194 (82.51/31.48) GSNNGSS......NSSNNGAG...GGGVGGAGG.GGivGGLGGNNNGSSNNG...PNS
195- 250 (67.59/15.06) GSVNVSSsvgqqqQQQQNGAGivqHNGVGGGGGvGG..GGLLGNPMGAMGGGssiPGG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.35| 14| 16| 18| 31| 2
---------------------------------------------------------------------------
18- 31 (28.69/14.48) FVQCLANPNYLHFL
57- 70 (26.66/13.11) YAKYLKFPMCLYFL
---------------------------------------------------------------------------
|