<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08006
| Description |
Mediator of RNA polymerase II transcription subunit 29 |
| Sequence | MMNQMGMMMQQQGVGVPGGPGGVGGVGMPGPGGVGVSPGMMQSPQMQQAQQQQVQQQQVQQQQQQVQQQQVQQQQAQQQQQQHSQTAQQQAQQTEKVDNISKVKVLVGPLRDALSTTIKAAAQSIQQNTLADAGSKTVDLNNAPRFDKHLEEFYSICDQIELNLKTAKLCMQQCTSSQQYLPIPVATSQPPLPETNALTYNQYLEVVKLQISYAKDIHDTLICAAQNISPSE |
| Length | 232 |
| Position | Tail |
| Organism | Anopheles dirus |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Nematocera> Culicoidea> Culicidae>
Anophelinae> Anopheles.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.609 |
| Instability index | 65.34 |
| Isoelectric point | 5.56 |
| Molecular weight | 25343.30 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP08006
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 62.09| 15| 15| 50| 64| 1
---------------------------------------------------------------------------
50- 64 (30.73/ 7.88) QQQQVQQQQVQQQQQ
67- 81 (31.36/ 8.19) QQQQVQQQQAQQQQQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.02| 14| 17| 13| 28| 2
---------------------------------------------------------------------------
13- 28 (23.42/20.21) GVGVpgGPGGVGGVGM
33- 46 (28.60/16.50) GVGV..SPGMMQSPQM
---------------------------------------------------------------------------
|