<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08001
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MANKMVGKGKLPVESEDAQKLRFQVELEFVQCLANPNYLHFLAQRGYFKDTAFVNYLKYLLYWKEPEYAKYLKFPMCLYFLDLLQYEHFRREIVSAQCCKFIDDQAILLWQHYTRRRTRLTALGTTSLTGLAVGGQPVGGGVQGTLLSNDPAIMPNSNNGTNNGSSANSNNGAGGVGGISNNNGSSNNGPNSGGVNVPTSVGQQQQQPQQQQQQQNGAGITQHNGVGGGMLGNPIGAMGSAGGLPGSGINQKVP |
| Length | 254 |
| Position | Middle |
| Organism | Anopheles dirus |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Nematocera> Culicoidea> Culicidae>
Anophelinae> Anopheles.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.444 |
| Instability index | 36.56 |
| Isoelectric point | 9.02 |
| Molecular weight | 27271.32 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP08001
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 73.07| 20| 52| 14| 33| 2
---------------------------------------------------------------------------
14- 33 (34.89/19.72) ESEDAQKLRFQVELEFVQCL
65- 84 (38.18/22.02) EPEYAKYLKFPMCLYFLDLL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 93.51| 20| 52| 177| 196| 3
---------------------------------------------------------------------------
177- 196 (37.14/14.24) GGISNN...NGSSNNGPNSGGVN
202- 221 (29.15/ 9.70) GQQQQQ...PQQQQQQQNGAGIT
229- 250 (27.22/ 8.61) GMLGNPigaMGSAGGLPGS.GIN
---------------------------------------------------------------------------
|