<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP07976
Description |
Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MNPGRLGLTPIVQENPLWISWHDSNWIPVLNPGNVMDYFSEKSNPFYDRTCNNEIVRMQRQSLELLNNMTGVEYIPLHVQDPILYVIRKQHRHSPTEATPMADYYIIAGTVYQAPDLASVFNSRILSTVHHLQTAFDEASSYSRYHPSKGYSWDFSSNKAIAEKTKTQTKKEAPVKEEPSSLFQRQRVDMLLGDLLRKFPLPLPQMTNNPAGVNSSDGNNANSNHTGGVSENDHAGSEHPMIKQEPTDGGVGRGSNNDVPPEKKMKL |
Length | 267 |
Position | Head |
Organism | Anopheles culicifacies |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Nematocera> Culicoidea> Culicidae>
Anophelinae> Anopheles> culicifacies species complex.
|
Aromaticity | 0.08 |
Grand average of hydropathy | -0.706 |
Instability index | 43.20 |
Isoelectric point | 6.36 |
Molecular weight | 30030.30 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP07976
No repeats found
|