<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP07964
| Description |
Mediator of RNA polymerase II transcription subunit 30 |
| Sequence | MVGQNTSHQPSQPSSQMGMQQPGGNVGPGNVMNNPQSQNQSVPPNQPGGGTTVQQQQKAEFNLLSLCRIGQETVQDIVSRFQEVFGILRSIQPPNGTNQGQLSSNDKKAKVQEQFRTIRLLFKRLRLLYDKCNDNCQQGMEYTHVESLIPLKGEIERTEPVHTEEYKKALQENRELVAMVQLKNKQLREIIDKIRLTIWEINTMLSMRRC |
| Length | 210 |
| Position | Head |
| Organism | Anopheles culicifacies |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Nematocera> Culicoidea> Culicidae>
Anophelinae> Anopheles> culicifacies species complex.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.762 |
| Instability index | 54.06 |
| Isoelectric point | 9.12 |
| Molecular weight | 23901.97 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP07964
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 67.62| 19| 22| 3| 24| 1
---------------------------------------------------------------------------
3- 21 (38.10/21.08) G..........QNTSHQPSQPSSQMGMQQ
27- 55 (29.53/ 8.74) GpgnvmnnpqsQNQSVPPNQPGGGTTVQQ
---------------------------------------------------------------------------
|