<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP07953
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MFNNYGNTMASDPFRKVEQYSPKSSPREGELTGATNLMAHYGLEHSYSKFSGKKVKEQLSSFLPNLPGVIDGPGHLDNSSLRSVIEKPPIVGKELLPLTSVQLAGFRLHPGPLPEQYKHLKTAPTRKHKNKHKKHKHKDGVAPPE |
| Length | 145 |
| Position | Head |
| Organism | Anopheles coluzzii |
| Kingdom | Metazoa |
| Lineage | |
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.835 |
| Instability index | 45.85 |
| Isoelectric point | 9.75 |
| Molecular weight | 16128.25 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP07953
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 75.95| 21| 35| 56| 76| 1
---------------------------------------------------------------------------
56- 76 (38.55/23.23) KEQLSSFLPNLPGVIDGPGHL
93- 113 (37.40/22.35) KELLPLTSVQLAGFRLHPGPL
---------------------------------------------------------------------------
|