<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP07934
| Description |
Mediator of RNA polymerase II transcription subunit 15 |
| Sequence | MAEDNSWKTSNFRQSVVNKINEAIQQTGMTSSKNGIEMENHVFHKARNKDEYLGFVARLILHVREMNTKHKNQQNAAAAAAAAAQQAQQDGGGNSSQQGGGGGGGGSGMPDPINALQTLASQGTRPQMMGQMGVGPGGPMGGQMGGAGQASNLLHSLRPQMQMGGMGVPMQGNRVGMGPGNQMGGMMGGPNQMQGPGAGMVGGMPGQMGVGIGPGGMSGGKIVGMGGQQQQMAQLNAMQVNQMQQAQQQQGGMPQPQQQQQQGGIAQGQGVPVQQMGVGPGGPNQMNPMVMGQIQAQLQNQNAMAGQQMGSVGGTMNAGNQMGQMVGANAVMNPQAMGMATNQVLRQQQQQQQQGMGQVQMGLGP |
| Length | 365 |
| Position | Tail |
| Organism | Anopheles christyi |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Nematocera> Culicoidea> Culicidae>
Anophelinae> Anopheles.
|
| Aromaticity | 0.01 |
| Grand average of hydropathy | -0.603 |
| Instability index | 44.56 |
| Isoelectric point | 10.08 |
| Molecular weight | 37445.07 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP07934
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
5| 251.71| 31| 32| 159| 189| 1
---------------------------------------------------------------------------
126- 146 (47.98/ 8.72) PQM.MGQM....GV.........GPG..GPMGGQMGG
159- 189 (74.74/18.64) PQMQMGGM....GVPMQGNRVGMGPG..NQMGGMMGG
228- 256 (41.96/ 6.49) QQQQMAQL....N.AMQVNQ..MQQA.qQQQGGMPQP
258- 292 (45.79/ 7.91) QQQQQGGIaqgqGVPVQ..QMGVGPGgpNQMNPMVMG
305- 328 (41.24/ 6.22) AGQQMGSV....G....GT...MNAG..NQMGQMVGA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 90.10| 15| 16| 195| 209| 2
---------------------------------------------------------------------------
100- 114 (28.47/ 6.84) GGGGGGGSGMPDPIN
195- 209 (33.43/ 9.41) GPGAGMVGGMPGQMG
213- 226 (28.19/ 6.69) GPG.GMSGGKIVGMG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.16| 14| 262| 85| 99| 3
---------------------------------------------------------------------------
85- 99 (22.75/ 8.43) QQAQQDGGGnSSQQG
349- 362 (28.41/ 8.06) QQQQQQGMG.QVQMG
---------------------------------------------------------------------------
|