<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP07933
Description |
Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MFNNYGNTMASDPFRKVEQYSPKSSPRAGGAGGRSPVVARQDSSGTLKTTIQLGKNPSILHSGPFYLMKEPPGEGELTGATNLMAHYGLEHSYSKFSGKKVKEQLSSFLPNLPGVIDGPGHLDNSSLRSVIEKPPIVGKELLPLTSVQLAGFRLHPGPLPEQYKHLKTAPTRKHKNKHKKHKHKDGVAPPEQSALEAAGLDTHEKKHKKQKRHEDDKERKKRKKEKKRKKQRHSPEHPAGGGGTASVPPQTQVY |
Length | 254 |
Position | Head |
Organism | Anopheles christyi |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Nematocera> Culicoidea> Culicidae>
Anophelinae> Anopheles.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -1.062 |
Instability index | 57.77 |
Isoelectric point | 10.02 |
Molecular weight | 27992.54 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP07933
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 98.54| 25| 27| 160| 185| 1
---------------------------------------------------------------------------
160- 182 (31.60/15.13) .......PEQyKHL.KTAPTRKHKNKHKKHK
183- 211 (39.34/15.52) HKDgvapPEQ.SAL.EAAGLDTHEKKHKKQK
213- 232 (27.60/ 9.30) HED...........dKERKKRKKEKKRKKQR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 53.06| 14| 209| 20| 37| 2
---------------------------------------------------------------------------
20- 33 (26.39/18.13) YSPKSSPRAGGAGG
66- 79 (26.67/ 8.53) YLMKEPPGEGELTG
---------------------------------------------------------------------------
|