<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP07880
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MANKMVGKGKLPVESEDAQKLRFQVELEFVQCLANPNYLHFLAQRGYFKDAAFVNYLKYLLYWKEPEYAKYLKFPMCLYFLDLLQYEHFRREIVSAQCCKFIDDQAILLWQHYTRRRTRLTALGTTSLTGLAVGGQPVGGGVQGTLLSNEPSIMPNSNNNNGNNNGNQTNSNGASGGISNNGSSNNGPNSGGINVPTSAMQQQQQNGAGIPQHNGVGGGGGGGMMGNPLGTMGTVGGITGGGINQKVP |
| Length | 248 |
| Position | Middle |
| Organism | Anopheles atroparvus |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Nematocera> Culicoidea> Culicidae>
Anophelinae> Anopheles.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.422 |
| Instability index | 32.17 |
| Isoelectric point | 9.02 |
| Molecular weight | 26610.69 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP07880
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 102.16| 24| 31| 149| 178| 1
---------------------------------------------------------------------------
149- 178 (38.95/23.13) NepsimpNSNNNNGNNN....G.........NQTNSNGASGGI
180- 210 (33.22/10.35) N......NGSSNNGPNS....GginvptsamQQQQQNGA..GI
212- 238 (29.99/ 7.41) .......QHNGVGGGGGggmmG.........NPLGTMGTVGGI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 64.00| 14| 16| 29| 42| 2
---------------------------------------------------------------------------
29- 42 (28.51/17.18) FVQCLANPNYLHFL
53- 60 (14.88/ 6.13) FV......NYLKYL
68- 80 (20.61/10.78) YAKYLKFPMCLYF.
---------------------------------------------------------------------------
|