<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP07873
Description |
Uncharacterized protein |
Sequence | MTHQNHQTNGASLEDCHTNFFALPTPVSVHLVGAGGAVDLLLAGGGNREGAPARNDAKATTAKTKRTSVSHYQTADLCGIRWRQLALGERPNASGDPLDDPVLRSYAKCLAVDILCVWRRVVAPKPKPKPELDTSSMFDLSIPGTGSGGSVVHPPLSLTAAKELWIFWYGEEPDLTDLVAPELLNSAR |
Length | 188 |
Position | Middle |
Organism | Anopheles atroparvus |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Nematocera> Culicoidea> Culicidae>
Anophelinae> Anopheles.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.235 |
Instability index | 36.38 |
Isoelectric point | 6.29 |
Molecular weight | 20119.56 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP07873
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.60| 16| 33| 82| 99| 1
---------------------------------------------------------------------------
82- 99 (20.87/16.76) WRQLaLGERPNASGDpLD
118- 133 (30.73/14.77) WRRV.VAPKPKPKPE.LD
---------------------------------------------------------------------------
|