<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP07859
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MVGKGKLPVESEDAQKLRFQVELEFVQCLANPNYLHFLAQRGYFKDAAFVNYLKYLLYWKEPEYAKYLKFPMCLYFLDLLQYEHFRREIVSAQCCKFIDDQAILLWQHYTRRRTRLTALGTTSLTGLAVGGQPVGGGVQGTLLSNDPAIMPNSSSNNGSNNGSSNSSNNGAGGGGTGGVGGVGGISNANNGNSNNGPNSGSVNVPSSVGQQQQQQQNGAGITQHNGVGGGGGVVGGGGMLGNPMGALGGGGSSLPGGGGINQKVP |
| Length | 265 |
| Position | Middle |
| Organism | Anopheles arabiensis (Mosquito) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Nematocera> Culicoidea> Culicidae>
Anophelinae> Anopheles.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.339 |
| Instability index | 37.76 |
| Isoelectric point | 8.86 |
| Molecular weight | 27532.40 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP07859
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 196.35| 42| 45| 130| 172| 1
---------------------------------------------------------------------------
130- 172 (78.60/26.42) GGQPVGGGVQGtLLSNDPAIMPNSSSNNGSNNGSSN..SS........NNGAG
174- 220 (60.81/17.35) GGTGGVGGVGG..ISNA....NNGNSNNGPNSGSVNvpSSvgqqqqqqQNGAG
230- 258 (56.94/15.88) GGGVVGGG..G.MLGNPMGAL...........GGGG..SS........LPGGG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.35| 14| 16| 25| 38| 2
---------------------------------------------------------------------------
25- 38 (28.69/16.12) FVQCLANPNYLHFL
64- 77 (26.66/14.61) YAKYLKFPMCLYFL
---------------------------------------------------------------------------
|