<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP07854
| Description |
Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | MSNAEAIQVSSLPLPPAQYINLYTDENIRKNRAPKPPAPIQDAYTMFGSPFSNDDNIIRPLESQGFKRLYPQHFDRRKELKKLNHSLLVNFLDLIDLLVHYPDSPRRAEKIEDLSLLFVHIHHLLNEFRPHQARETLRVMMELQKRQRIETAQRFQNHLEKVREMVKNAFASLPDLTDADRLAGGLEPMDVGESGDLAGGRGEGCHPLDRLMCELVDRM |
| Length | 219 |
| Position | Middle |
| Organism | Anopheles arabiensis (Mosquito) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Nematocera> Culicoidea> Culicidae>
Anophelinae> Anopheles.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.564 |
| Instability index | 51.91 |
| Isoelectric point | 6.31 |
| Molecular weight | 25229.59 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP07854
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 70.72| 24| 26| 73| 98| 1
---------------------------------------------------------------------------
73- 98 (36.38/27.71) HF.DRRKELKKLNH.SLLvnFLDLIDLL
100- 125 (34.34/19.97) HYpDSPRRAEKIEDlSLL..FVHIHHLL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 66.68| 18| 18| 7| 24| 2
---------------------------------------------------------------------------
7- 24 (32.81/20.58) IQVSSLPLPPAQYINLYT
28- 45 (33.86/21.45) IRKNRAPKPPAPIQDAYT
---------------------------------------------------------------------------
|