<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP07847
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MFNNYGNTMASDPFRKVEQYSPKSSPRAGGAGGRSPVVARQDSSGTLKTTIQLGKNPSILHSGPFYLMKEPPGEGELTGATNLMAHYGLEHSYSKFSGKKVKEQLSSFLPNLPGVIDGPGHLDNSSLRSVIEKPPIVGKELLPLTSVQLAGFRLHPGPLPEQYKHLKTAPTRKHKNKHKKHKHKDGVAPPEQSALEAAGLDTHEKKHKKQKRHEDDKERKKRKKEKKRKKQRHSPEHPAGGGGGTASVPPQTQVY |
| Length | 255 |
| Position | Head |
| Organism | Anopheles arabiensis (Mosquito) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Nematocera> Culicoidea> Culicidae>
Anophelinae> Anopheles.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -1.059 |
| Instability index | 58.06 |
| Isoelectric point | 10.02 |
| Molecular weight | 28049.59 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP07847
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 98.54| 25| 27| 160| 185| 1
---------------------------------------------------------------------------
160- 182 (31.60/17.04) .......PEQyKHL.KTAPTRKHKNKHKKHK
183- 211 (39.34/17.48) HKDgvapPEQ.SAL.EAAGLDTHEKKHKKQK
213- 232 (27.60/10.54) HED...........dKERKKRKKEKKRKKQR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.84| 15| 210| 20| 37| 2
---------------------------------------------------------------------------
21- 35 (25.94/ 8.59) SPKSSPRAGGAGGRS
234- 248 (26.90/ 7.17) SPEHPAGGGGGTASV
---------------------------------------------------------------------------
|