<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP07841
| Description |
Mediator of RNA polymerase II transcription subunit 8 |
| Sequence | MQREEKQMDMLLEAVLNRLNDLKHSIGAMIHRLETEYETINWPTFLDNFALISGHLTGLSKILSSEIGTPLRNLTVLPLLLTPERDEALLQLTEGRIPVFSHDLVPDYLRTKPDPGAESRMAAHEAKANNLQPDTAAKQVAQYNKVISHVWDIVSKAREEWDTEASSRPGIQQTSSLADTQALVAAVGVGNGLTMPVGPGGVPNAGIMIPPAIRQASPMSAVSPGGAGPLGKMPSGIKTNIKSANQVHPYR |
| Length | 251 |
| Position | Head |
| Organism | Aedes albopictus (Asian tiger mosquito) (Stegomyia albopicta) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Nematocera> Culicoidea> Culicidae>
Culicinae> Aedini> Aedes> Stegomyia.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.245 |
| Instability index | 37.05 |
| Isoelectric point | 6.17 |
| Molecular weight | 27132.73 |
| Publications | PubMed=26483478
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP07841
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 63.95| 18| 22| 196| 214| 1
---------------------------------------------------------------------------
196- 214 (32.83/17.50) P...VGPGGVPNAGIMiPPAIR
218- 238 (31.11/12.94) PmsaVSPGGAGPLGKM.PSGIK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 46.21| 14| 15| 62| 75| 2
---------------------------------------------------------------------------
62- 75 (23.34/15.84) ILSSEIGTPLRNLT
80- 93 (22.87/15.38) LLTPERDEALLQLT
---------------------------------------------------------------------------
|