| Description | Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MAHYGLEHSYSKFSGKKVKEQLSSFLPNLPGVIDGPGHLDNSSLRSVIEKPPIGGKDLLPLTSVQLAGFRLHPGPLPEQYKHLKTAPTRKHKNKHKKHKYKEGVAPQSEQSSLEASGLDTHEKKHKKQKRHEDDKERKKRKKEKKRKKQRHSPEHPGSGATSMPPQTQVF |
| Length | 170 |
| Position | Head |
| Organism | Aedes albopictus (Asian tiger mosquito) (Stegomyia albopicta) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Diptera> Nematocera> Culicoidea> Culicidae> Culicinae> Aedini> Aedes> Stegomyia. |
| Aromaticity | 0.05 |
| Grand average of hydropathy | -1.327 |
| Instability index | 62.77 |
| Isoelectric point | 10.07 |
| Molecular weight | 19262.80 |
| Publications | PubMed=26483478 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP07840
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 61.35| 11| 18| 121| 131| 1
---------------------------------------------------------------------------
72- 82 (19.32/ 6.44) HPGPLPEQYKH
91- 101 (19.37/ 6.47) HKNKHKKHKYK
121- 131 (22.66/ 8.62) HEKKHKKQKRH
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 38.70| 11| 16| 37| 47| 2
---------------------------------------------------------------------------
37- 47 (19.45/10.34) GHLDNSSLRSV
54- 64 (19.25/10.17) GGKDLLPLTSV
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) LDTHEKKHKKQKRHEDDKERKKRKKEKKRKKQRHSPEHPGS 2) QYKHLKTAPTRKHKNKHKKHKYKEGVA | 118 79 | 158 105 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab