<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP07831

Description Mediator of RNA polymerase II transcription subunit 15
SequenceMAEDNSWKTPSFRQSVVNKINEAIQQSGMTSSKNGLEMENHVFQKARNKDEYLGYVARLILHVREMNTKNKNQQNPAGSAQDGGNPNQQGGGMPDPINALQTLATQGTRPQMMGGQMGGPGPGGPMGNQMGGGGNASNLLNTLNRPQMPMTGGMANMQGRGECPECRKRMPNQMGGAMGPGGMSGGKIVGQMNPMGGMNPMQMGVGGMPQGAGQQQPQGPQGQGQGGPGGPNQMNPMGGMGMQVNPGGHMGQNAMNQQMSQVGMSSGGNQMGNLGGNSPMNTGMGGIPPNQVIRQQMPPGMNPNQQQLGMAGGQMGQMNPGVGGPGGNLGPVQQQQQPGQVGIPGMGPGGGPGNLQQSNNPQQQPQGGPNAPPGQMNQVGGPGANMQAMSNQGNFVPIGANPMVRKQDMMSGGQVYPGGVVRSVTPNQFLRQSPSPSVPSPAGPGSIGPQSHPGQMIPSPALIPSPSPQVSSNIPAPRNIGQSPGQSLNTPGQAAAPSPLNPQEEHLYKEKYRSLQKYIEPLKRMIAKMEHDDVDKMGKMKRLLDILCNPTCRIPLETLYKCEAALTSQLGTIREPPLNNPLVEAVSANLQSPLGNHTLQRTFRPCLEALFGPDIKNLPSPAKQSRLAMDEPSSSALSGGPEIPHILQGEIARLDQKFKVSLDPCAIGDTKTIKLICWLDDKHLPCVPPIAVTIPEEYPFTSPSCSLIEQEYNATPFLIQVQKSLVARICKLPEMFSLSHLLDTWEMSVRQACSPNPSRVAPSATSVLLGM
Length771
PositionTail
OrganismAedes albopictus (Asian tiger mosquito) (Stegomyia albopicta)
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Diptera> Nematocera> Culicoidea> Culicidae> Culicinae> Aedini> Aedes> Stegomyia.
Aromaticity0.03
Grand average of hydropathy-0.577
Instability index62.36
Isoelectric point8.97
Molecular weight81165.84
Publications
PubMed=26483478

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
ECO:0000256	RuleBase:RU364148
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro

Interaction

Binary Interactions











Repeat regions





Repeats

>MDP07831
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     109.30|      22|      24|     174|     196|       1
---------------------------------------------------------------------------
  169-  193 (34.46/ 8.82)	RMPnqMGGAMGPGGMSGGKiVGQMN
  194-  216 (35.58/ 7.18)	PMGgmNPMQMGVGGMPQG..AGQQQ
  217-  235 (39.26/ 8.82)	PQG...PQGQGQGG.PGGP..NQMN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             6|     194.44|      24|      24|     313|     336|       2
---------------------------------------------------------------------------
  236-  253 (31.78/ 6.20)	PM...G..GMGMQVNPG.GHMGQ..N
  254-  272 (31.48/ 6.05)	AMNQQM..SQVG.MS.S..G.GNQMG
  273-  291 (32.04/ 6.33)	N..L.G..GNSP.MNTGMGGIPPN.Q
  313-  330 (33.46/ 7.04)	........GQMGQMNPGVGGPGGNLG
  331-  351 (34.18/ 7.40)	PVQQQQqpGQVG..IPGM.GPGG..G
  352-  372 (31.50/ 6.06)	PGNLQQ..SNNPQQQPQ.GGPNAP..
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      78.34|      24|      25|     589|     613|       4
---------------------------------------------------------------------------
  589-  613 (41.96/24.39)	NLQSPLGNHTLQRTfRPCLEALF.GP
  617-  641 (36.38/16.68)	NLPSPAKQSRLAMD.EPSSSALSgGP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      84.28|      29|      34|      84|     117|       5
---------------------------------------------------------------------------
   72-  105 (40.00/20.91)	NQQNPAGSA..qdgGNP..NQQGGGmPDPINALQTLaT
  109-  144 (44.28/11.57)	RPQMMGGQMggpgpGGPmgNQMGGG.GNASNLLNTL.N
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      38.64|      11|      32|     458|     469|       6
---------------------------------------------------------------------------
  458-  469 (17.96/ 9.18)	PSPALIpSPSPQ
  475-  485 (20.67/ 6.07)	PAPRNI.GQSPG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      41.48|      13|     146|     145|     161|       7
---------------------------------------------------------------------------
  300-  312 (26.10/ 7.11)	GMNPNQ......QQLGMAG
  375-  393 (15.37/ 7.04)	QMNQVGgpganmQAMSNQG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      66.89|      19|      23|     651|     673|       8
---------------------------------------------------------------------------
  651-  673 (28.15/26.27)	IARLDQKFKVSLDPCAIgdtkTI
  676-  694 (38.74/24.23)	ICWLDDKHLPCVPPIAV....TI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      48.78|      13|      23|     544|     556|      10
---------------------------------------------------------------------------
  544-  556 (25.08/15.75)	LDILCNPTCRIPL
  570-  582 (23.70/14.39)	LGTIREPPLNNPL
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP07831 with Med15 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) MAEDNSWKTPSFRQSVVNKINEAIQQSGMTSSKNGLEMENHVFQK
2) VREMNTKNKNQQNPAGSAQDGGNPNQQGGGMPDPINALQTLATQGTRPQMMGGQMGGPGPGGPMGNQMGGGGNASNLLNTLNRPQMPMTGGMANMQGRGECPECRKRMPNQMGGAMGPGGMSGGKIVGQMNPMGGMNPMQMGVGGMPQGAGQQQPQGPQGQGQGGPGGPNQMNPMGGMGMQVNPGGHMGQNAMNQQMSQVGMSSGGNQMGNLGGNSPMNTGMGGIPPNQVIRQQMPPGMNPNQQQLGMAGGQMGQMNPGVGGPGGNLGPVQQQQQPGQVGIPGMGPGGGPGNLQQSNNPQQQPQGGPNAPPGQMNQVGGPGANMQAMSNQGNFVPIGANPMVRKQDMMSGGQVYPGGVVRSVTPNQFLRQSPSPSVPSPAGPGSIGPQSHPGQMIPSPALIPSPSPQVSSNIPAPRNIGQSPGQSLNTPGQAAAPSPLNPQEEHL
1
63
45
507










Molecular Recognition Features






MoRF SequenceStartStop




NANANA