<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP07827
Description |
Cyclin C |
Sequence | MAGNFWQSSHHQQWILDKQDLIRERQHDLKNLTEEEYQKIFMFFANVIQVLGEQLKLRQQVIATATVYFKRFYARNSLKCIDPLLLAPTCILLASKVEEFGVISNSRLITTCQTVIKNKFSYAYQQEFPYRTNHILECEFYLLENLDCCLIVYQPYRPLLQLIQDIGQEDQLLTLTWRLINDSLRTDVSLLYPPYQIAIGCLQIACVILQKELKAWFAELNVDMEKVQEIARAILNVFELWKSYDEKEIQGLLEKMPKPKPAPQR |
Length | 265 |
Position | Kinase |
Organism | Aedes albopictus (Asian tiger mosquito) (Stegomyia albopicta) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Nematocera> Culicoidea> Culicidae>
Culicinae> Aedini> Aedes> Stegomyia.
|
Aromaticity | 0.11 |
Grand average of hydropathy | -0.142 |
Instability index | 52.23 |
Isoelectric point | 6.14 |
Molecular weight | 31228.00 |
Publications | PubMed=26483478
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP07827
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 66.55| 21| 26| 105| 130| 1
---------------------------------------------------------------------------
105- 130 (29.24/29.28) NSrlITTCQTVIKNKFSYA...YQqefPY
133- 156 (37.30/21.12) NH..ILECEFYLLENLDCClivYQ...PY
---------------------------------------------------------------------------
|