<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP07822
| Description |
Uncharacterized protein |
| Sequence | MLLGDLLRKFPLPVPQMHQTQNVPHQNQNGTAGPNNTDGQDTVNLKQEPPEHALNDSNDPGASILLSGIKEESRSDMKPPPEKKIKM |
| Length | 87 |
| Position | Head |
| Organism | Aedes albopictus (Asian tiger mosquito) (Stegomyia albopicta) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Nematocera> Culicoidea> Culicidae>
Culicinae> Aedini> Aedes> Stegomyia.
|
| Aromaticity | 0.01 |
| Grand average of hydropathy | -1.007 |
| Instability index | 58.63 |
| Isoelectric point | 5.83 |
| Molecular weight | 9575.68 |
| Publications | PubMed=26483478
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP07822
No repeats found
|