<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP07818
| Description |
Uncharacterized protein |
| Sequence | MKIKRESVWRNYESNSLNKFRKQSTNETPEKSLKEFRETTQKSKRISKEILAEIPEESLKVSKYKSRNSSGGGSSGSGHTGGSDIEKLKQEFHPSSSSAPTTPLSNVAQSPTGGNDFSLPFNKLPGDVSPLHSSMLPNVIQKMFPGHDSSTLMRRSPNLDHQSSGWILLDLWERFHNAHDPYQIGSASFPFACRYAKPRHGFLEQQRLGRTVYGPRGKLSKSFRHLDIYKVSKKKLMVEKWFGAKNKIVAVRTVCSHIDL |
| Length | 260 |
| Position | Middle |
| Organism | Aedes albopictus (Asian tiger mosquito) (Stegomyia albopicta) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Nematocera> Culicoidea> Culicidae>
Culicinae> Aedini> Aedes> Stegomyia.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.787 |
| Instability index | 58.03 |
| Isoelectric point | 9.95 |
| Molecular weight | 29333.94 |
| Publications | PubMed=26483478
|
Function
| Annotated function |
|
| GO - Cellular Component | ribosome GO:0005840 IEA:InterPro
|
| GO - Biological Function | rRNA binding GO:0019843 IEA:InterPro
structural constituent of ribosome GO:0003735 IEA:InterPro
|
| GO - Biological Process | translation GO:0006412 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP07818
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 87.51| 27| 29| 57| 84| 1
---------------------------------------------------------------------------
57- 84 (43.69/23.56) ESLKvSKYKSRNSSGGGSSGS....GHTGGSD
86- 116 (43.82/20.10) EKLK.QEFHPSSSSAPTTPLSnvaqSPTGGND
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 57.24| 15| 15| 16| 30| 2
---------------------------------------------------------------------------
2- 13 (14.41/ 6.94) ...KIK..........RESVWRNYE
16- 30 (26.51/18.38) SLNKFR..........KQSTNETPE
32- 56 (16.32/ 8.75) SLKEFRettqkskrisKEILAEIPE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 59.58| 17| 30| 132| 148| 3
---------------------------------------------------------------------------
132- 148 (32.61/24.46) HSS...MLPNVIQKMFPGHD
161- 180 (26.97/19.07) HQSsgwILLDLWERFHNAHD
---------------------------------------------------------------------------
|